PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011619m
Common NameCARUB_v10011619mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 514aa    MW: 56956.7 Da    PI: 3.9471
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011619mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.92.7e-30340397259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dg++WrKYGqK+vkg+++prsY++Ct ++C+vkk+ver a++ k++++ Y g Hnh+
  Carubv10011619m 340 EDGFRWRKYGQKVVKGNPNPRSYFKCTNNDCNVKKHVERGADNFKILVTSYDGIHNHP 397
                      7********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.0E-30325399IPR003657WRKY domain
SuperFamilySSF1182903.4E-25334399IPR003657WRKY domain
PROSITE profilePS5081130.572334399IPR003657WRKY domain
SMARTSM007743.1E-34339398IPR003657WRKY domain
PfamPF031069.6E-23340397IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MSDFDGNFNE STSCWAPPFS PSPRAILAMI DQAEDDGLDL ISEMFPHTNL PRDHSAQSSE  60
QRSGLGQRLA ARVGFSPPPL DTENISPSAA SLRSSTTVPP PVSAIPPGFI PSTLLQSPNM  120
VTDSSQMIPA PSSDTNYGPQ GMVETSGEGN APTLIFNNDH PYQPVNADLP LLDVFDDVPT  180
EESVYLPTYE TDHVEPIGDS LVPNSFEHEF VGDANVNFIS NEGTESVKDS ESDDELDFDF  240
EFEDEDEAEA EAEDNDEDKA EDEDEDNDED GNEDEDEDDE EDENDEEEAD HDDEADFDDA  300
EPSSPKRRKF EASSNMIGAT RTNKAQRVIL QMESDEDNPE DGFRWRKYGQ KVVKGNPNPR  360
SYFKCTNNDC NVKKHVERGA DNFKILVTSY DGIHNHPPPP ARCRINSGPR NRSGTTTTTQ  420
NQSYRTDRLG RFPAPSSVIT PMEMMPLSSF TPPLDMSKVY MTGLNKLPNF SVFQNPGYMY  480
RNDEPMMNVV PNGSGIYGGI RHRLFAEFGV NLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-22330399877Probable WRKY transcription factor 4
2lex_A1e-22330399877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3033490.0AJ303349.1 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5 and ORF6 (partial).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304579.10.0hypothetical protein CARUB_v10011619mg
SwissprotQ9LG051e-167WRK10_ARATH; Probable WRKY transcription factor 10
TrEMBLQ9ARF40.0Q9ARF4_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10042080.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102991733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.12e-79WRKY DNA-binding protein 10
Publications ? help Back to Top
  1. Rossberg M, et al.
    Comparative sequence analysis reveals extensive microcolinearity in the lateral suppressor regions of the tomato, Arabidopsis, and Capsella genomes.
    Plant Cell, 2001. 13(4): p. 979-88
    [PMID:11283350]